Lineage for d3cfih_ (3cfi H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941263Family d.24.1.5: EpsJ-like [160127] (2 proteins)
    automatically mapped to Pfam PF11612
  6. 2941267Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 2941268Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries)
    Uniprot Q7MPZ0 48-213
  8. 2941271Domain d3cfih_: 3cfi H: [173206]
    Other proteins in same PDB: d3cfia_, d3cfic1, d3cfic2, d3cfid_, d3cfif1, d3cfif2, d3cfig_, d3cfii1, d3cfii2, d3cfij_, d3cfil1, d3cfil2
    automated match to d2retb1
    complexed with cl

Details for d3cfih_

PDB Entry: 3cfi (more details), 2.58 Å

PDB Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
PDB Compounds: (H:) Type II secretory pathway, PSEUDOPILIN EpsJ

SCOPe Domain Sequences for d3cfih_:

Sequence, based on SEQRES records: (download)

>d3cfih_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf
arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr
fydgkqwinewsneltlpaaisveltlkdygkiartyltp

Sequence, based on observed residues (ATOM records): (download)

>d3cfih_ d.24.1.5 (H:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngekkllhwadylldsdnkgimfarl
gwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfyd
gkqwinewsneltlpaaisveltlkdygkiartyltp

SCOPe Domain Coordinates for d3cfih_:

Click to download the PDB-style file with coordinates for d3cfih_.
(The format of our PDB-style files is described here.)

Timeline for d3cfih_: