Lineage for d3cfig_ (3cfi G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185566Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2185567Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2185656Family d.24.1.7: GSPII I/J protein-like [160135] (2 proteins)
    Pfam PF02501
  6. 2185657Protein Pseudopilin EpsI [160136] (1 species)
  7. 2185658Species Vibrio vulnificus [TaxId:672] [160137] (2 PDB entries)
    Uniprot Q7MPZ1 63-143
  8. 2185665Domain d3cfig_: 3cfi G: [173205]
    Other proteins in same PDB: d3cfib_, d3cfic_, d3cfie_, d3cfif_, d3cfih_, d3cfii_, d3cfik_, d3cfil_
    automated match to d2reta1
    complexed with cl

Details for d3cfig_

PDB Entry: 3cfi (more details), 2.58 Å

PDB Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
PDB Compounds: (G:) Type II secretory pathway, pseudopilin EpsI

SCOPe Domain Sequences for d3cfig_:

Sequence, based on SEQRES records: (download)

>d3cfig_ d.24.1.7 (G:) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
intvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllk
afdvsvaaekqaspiitvrsy

Sequence, based on observed residues (ATOM records): (download)

>d3cfig_ d.24.1.7 (G:) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
intvgyleqkmfaamvadnqmamvmlnpknkasngeeelagqtwywkvapvalkafdvsv
aaekqspiitvrsy

SCOPe Domain Coordinates for d3cfig_:

Click to download the PDB-style file with coordinates for d3cfig_.
(The format of our PDB-style files is described here.)

Timeline for d3cfig_: