Lineage for d3cfie_ (3cfi E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509544Family d.24.1.5: EpsJ-like [160127] (2 protein domains)
    automatically mapped to Pfam PF11612
  6. 2509548Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 2509549Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries)
    Uniprot Q7MPZ0 48-213
  8. 2509551Domain d3cfie_: 3cfi E: [173204]
    Other proteins in same PDB: d3cfia_, d3cfic1, d3cfic2, d3cfid_, d3cfif1, d3cfif2, d3cfig_, d3cfii1, d3cfii2, d3cfij_, d3cfil1, d3cfil2
    automated match to d2retb1
    complexed with cl

Details for d3cfie_

PDB Entry: 3cfi (more details), 2.58 Å

PDB Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
PDB Compounds: (E:) Type II secretory pathway, PSEUDOPILIN EpsJ

SCOPe Domain Sequences for d3cfie_:

Sequence, based on SEQRES records: (download)

>d3cfie_ d.24.1.5 (E:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
nelsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgim
farlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnv
rfydgkqwinewsneltlpaaisveltlkdygkiartyltpegn

Sequence, based on observed residues (ATOM records): (download)

>d3cfie_ d.24.1.5 (E:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
nelsqertarlnelqralvmmdsdfrqialrqtrtnskkllhwadylldsdnkgimfarl
gwhnpqqprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfydgk
qwinewsneltlpaaisveltlkdygkiartyltpegn

SCOPe Domain Coordinates for d3cfie_:

Click to download the PDB-style file with coordinates for d3cfie_.
(The format of our PDB-style files is described here.)

Timeline for d3cfie_: