Lineage for d3cfib_ (3cfi B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185566Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2185567Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2185638Family d.24.1.5: EpsJ-like [160127] (2 proteins)
    automatically mapped to Pfam PF11612
  6. 2185642Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 2185643Species Vibrio vulnificus [TaxId:672] [160129] (2 PDB entries)
    Uniprot Q7MPZ0 48-213
  8. 2185648Domain d3cfib_: 3cfi B: [173202]
    Other proteins in same PDB: d3cfia_, d3cfic_, d3cfid_, d3cfif_, d3cfig_, d3cfii_, d3cfij_, d3cfil_
    automated match to d2retb1
    complexed with cl

Details for d3cfib_

PDB Entry: 3cfi (more details), 2.58 Å

PDB Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
PDB Compounds: (B:) Type II secretory pathway, PSEUDOPILIN EpsJ

SCOPe Domain Sequences for d3cfib_:

Sequence, based on SEQRES records: (download)

>d3cfib_ d.24.1.5 (B:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf
arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr
fydgkqwinewsneltlpaaisveltlkdygkiartyltpeg

Sequence, based on observed residues (ATOM records): (download)

>d3cfib_ d.24.1.5 (B:) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngeskkllhwadylldsdnkgimfar
lgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfy
dgkqwinewsneltlpaaisveltlkdygkiartyltpeg

SCOPe Domain Coordinates for d3cfib_:

Click to download the PDB-style file with coordinates for d3cfib_.
(The format of our PDB-style files is described here.)

Timeline for d3cfib_: