Lineage for d3cf9f_ (3cf9 F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201078Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1201079Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1201474Family d.38.1.6: FabZ-like [110902] (1 protein)
  6. 1201475Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 1201476Species Helicobacter pylori [TaxId:210] [188573] (13 PDB entries)
  8. 1201537Domain d3cf9f_: 3cf9 F: [173200]
    automated match to d1u1za_
    complexed with agi, ben, cl

Details for d3cf9f_

PDB Entry: 3cf9 (more details), 2.6 Å

PDB Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Helicobacter pylori in complex with apigenin
PDB Compounds: (F:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d3cf9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf9f_ d.38.1.6 (F:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli
vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg
miwqvggtaqvdgkvvaeaelkamiae

SCOPe Domain Coordinates for d3cf9f_:

Click to download the PDB-style file with coordinates for d3cf9f_.
(The format of our PDB-style files is described here.)

Timeline for d3cf9f_: