Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.6: FabZ-like [110902] (1 protein) |
Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
Species Helicobacter pylori [TaxId:210] [188573] (13 PDB entries) |
Domain d3cf9f_: 3cf9 F: [173200] automated match to d1u1za_ complexed with agi, ben, cl |
PDB Entry: 3cf9 (more details), 2.6 Å
SCOPe Domain Sequences for d3cf9f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cf9f_ d.38.1.6 (F:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]} qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg miwqvggtaqvdgkvvaeaelkamiae
Timeline for d3cf9f_: