Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.6: FabZ-like [110902] (1 protein) automatically mapped to Pfam PF07977 |
Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species) |
Species Helicobacter pylori [TaxId:210] [188573] (15 PDB entries) |
Domain d3cf8e_: 3cf8 E: [173193] automated match to d1u1za_ complexed with ben, cl, que |
PDB Entry: 3cf8 (more details), 2.4 Å
SCOPe Domain Sequences for d3cf8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cf8e_ d.38.1.6 (E:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]} qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh kgmiwqvggtaqvdgkvvaeaelkamiaere
Timeline for d3cf8e_: