Lineage for d3cf8e_ (3cf8 E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646506Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 1646507Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 1646508Species Helicobacter pylori [TaxId:210] [188573] (15 PDB entries)
  8. 1646537Domain d3cf8e_: 3cf8 E: [173193]
    automated match to d1u1za_
    complexed with ben, cl, que

Details for d3cf8e_

PDB Entry: 3cf8 (more details), 2.4 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase (fabz) from helicobacter pylori in complex with quercetin
PDB Compounds: (E:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d3cf8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf8e_ d.38.1.6 (E:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
kgmiwqvggtaqvdgkvvaeaelkamiaere

SCOPe Domain Coordinates for d3cf8e_:

Click to download the PDB-style file with coordinates for d3cf8e_.
(The format of our PDB-style files is described here.)

Timeline for d3cf8e_: