Lineage for d3cf1b3 (3cf1 B:471-763)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990157Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 990354Protein Membrane fusion ATPase VCP/p97 [64038] (1 species)
  7. 990355Species Mouse (Mus musculus) [TaxId:10090] [64039] (4 PDB entries)
  8. 990360Domain d3cf1b3: 3cf1 B:471-763 [173182]
    Other proteins in same PDB: d3cf1a1, d3cf1a4, d3cf1b1, d3cf1b4, d3cf1c1, d3cf1c4
    complete low resolution structure
    complexed with adp, af3

Details for d3cf1b3

PDB Entry: 3cf1 (more details), 4.4 Å

PDB Description: Structure of P97/vcp in complex with ADP/ADP.alfx
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d3cf1b3:

Sequence, based on SEQRES records: (download)

>d3cf1b3 c.37.1.20 (B:471-763) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}
vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka
ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni
gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde
ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseirre
rerqtnpsameveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlq

Sequence, based on observed residues (ATOM records): (download)

>d3cf1b3 c.37.1.20 (B:471-763) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}
vpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllaka
ianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggni
gdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpde
ksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseivpe
irrdhfeeamrfarrsvsdndirkyemfaqtlq

SCOPe Domain Coordinates for d3cf1b3:

Click to download the PDB-style file with coordinates for d3cf1b3.
(The format of our PDB-style files is described here.)

Timeline for d3cf1b3: