Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein automated matches [190916] (10 species) not a true protein |
Species Cryptococcus liquefaciens [TaxId:104408] [188577] (1 PDB entry) |
Domain d3ce1a_: 3ce1 A: [173172] automated match to d1b4la_ complexed with act, cu, zn |
PDB Entry: 3ce1 (more details), 1.2 Å
SCOPe Domain Sequences for d3ce1a_:
Sequence, based on SEQRES records: (download)
>d3ce1a_ b.1.8.1 (A:) automated matches {Cryptococcus liquefaciens [TaxId: 104408]} ikaiavlkgdspvqgvitftqessggpvtvsgeiknmdanaqrgfhvhqfgdnsngctsa gphfnptgtnhgdrtaevrhvgdlgnvktdasgvakvqisdsqlslvgphsiigrtivih ageddlgktdhpeslktgnagarsacgvigiaa
>d3ce1a_ b.1.8.1 (A:) automated matches {Cryptococcus liquefaciens [TaxId: 104408]} ikaiavlkgdspvqgvitftqegpvtvsgeiknmdanaqrgfhvhqfgdnsngctsagph fnptgtnhgdrtaevrhvgdlgnvktdasgvakvqisdsqlslvgphsiigrtivihage ddlgktdhpeslktgnagarsacgvigiaa
Timeline for d3ce1a_: