Lineage for d3ce1a_ (3ce1 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 937129Protein automated matches [190916] (7 species)
    not a true protein
  7. 937133Species Cryptococcus liquefaciens [TaxId:104408] [188577] (1 PDB entry)
  8. 937134Domain d3ce1a_: 3ce1 A: [173172]
    automated match to d1b4la_
    complexed with act, cu, zn

Details for d3ce1a_

PDB Entry: 3ce1 (more details), 1.2 Å

PDB Description: crystal structure of the cu/zn superoxide dismutase from cryptococcus liquefaciens strain n6
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3ce1a_:

Sequence, based on SEQRES records: (download)

>d3ce1a_ b.1.8.1 (A:) automated matches {Cryptococcus liquefaciens [TaxId: 104408]}
ikaiavlkgdspvqgvitftqessggpvtvsgeiknmdanaqrgfhvhqfgdnsngctsa
gphfnptgtnhgdrtaevrhvgdlgnvktdasgvakvqisdsqlslvgphsiigrtivih
ageddlgktdhpeslktgnagarsacgvigiaa

Sequence, based on observed residues (ATOM records): (download)

>d3ce1a_ b.1.8.1 (A:) automated matches {Cryptococcus liquefaciens [TaxId: 104408]}
ikaiavlkgdspvqgvitftqegpvtvsgeiknmdanaqrgfhvhqfgdnsngctsagph
fnptgtnhgdrtaevrhvgdlgnvktdasgvakvqisdsqlslvgphsiigrtivihage
ddlgktdhpeslktgnagarsacgvigiaa

SCOPe Domain Coordinates for d3ce1a_:

Click to download the PDB-style file with coordinates for d3ce1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ce1a_: