SCOPe 2.01: Domain d1wdcc_: 1wdc C:

Lineage for d1wdcc_ (1wdc C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries)
   Uniprot P07291

8. Domain d1wdcc_: 1wdc C: [17317]
   Other proteins in same PDB: d1wdcb_
   complexed with ca, mg

Details for d1wdcc_

PDB Entry: 1wdc, 2 Å

PDB Description: scallop myosin regulatory domain

PDB Compounds: (C:) scallop myosin

SCOPe Domain Sequences for d1wdcc_:

Sequence; same for both SEQRES and ATOM records:

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
deiikltdlqedlegnvkyedfvkkvmagpyp

Timeline for d1wdcc_:

• d1wdcc_ first appeared (with stable ids) in SCOP 1.55
  
• d1wdcc_ appears in SCOP 1.75
  
• d1wdcc_ appears in SCOPe 2.02
  
• d1wdcc_ appears in the current release, SCOPe 2.08