Lineage for d1wdcc_ (1wdc C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47726Protein Myosin Regulatory Chain [47527] (2 species)
  7. 47727Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (5 PDB entries)
  8. 47728Domain d1wdcc_: 1wdc C: [17317]
    Other proteins in same PDB: d1wdcb_

Details for d1wdcc_

PDB Entry: 1wdc (more details), 2 Å

PDB Description: scallop myosin regulatory domain

SCOP Domain Sequences for d1wdcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians)}
lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
deiikltdlqedlegnvkyedfvkkvmagpyp

SCOP Domain Coordinates for d1wdcc_:

Click to download the PDB-style file with coordinates for d1wdcc_.
(The format of our PDB-style files is described here.)

Timeline for d1wdcc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wdcb_