Lineage for d3cdsb_ (3cds B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009635Domain d3cdsb_: 3cds B: [173165]
    automated match to d1nyxa_
    protein/DNA complex; complexed with grr

Details for d3cdsb_

PDB Entry: 3cds (more details), 2.65 Å

PDB Description: Crystal structure of the complex between PPAR-gamma and the agonist LT248 (clofibric acid analogue)
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3cdsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cdsb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d3cdsb_:

Click to download the PDB-style file with coordinates for d3cdsb_.
(The format of our PDB-style files is described here.)

Timeline for d3cdsb_: