SCOPe 2.05: Domain d3cdod_: 3cdo D:

Lineage for d3cdod_ (3cdo D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3cdod_: 3cdo D: [173159]
   automated match to d1l34a_
   complexed with hez, mpd, so4; mutant

Details for d3cdod_

PDB Entry: 3cdo, 1.87 Å

PDB Description: bacteriophage t4 lysozyme mutant r96v in wildtype background at low temperature

PDB Compounds: (D:) lysozyme

SCOPe Domain Sequences for d3cdod_:

Sequence; same for both SEQRES and ATOM records:

>d3cdod_ d.2.1.3 (D:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrvcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d3cdod_:

• d3cdod_ first appeared in SCOPe 2.01
  
• d3cdod_ appears in SCOPe 2.04
  
• d3cdod_ appears in SCOPe 2.06
  
• d3cdod_ appears in the current release, SCOPe 2.08