Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries) |
Domain d3cdfd_: 3cdf D: [173152] automated match to d1igml_ |
PDB Entry: 3cdf (more details), 1.53 Å
SCOPe Domain Sequences for d3cdfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cdfd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} stdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgv psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik
Timeline for d3cdfd_: