Lineage for d3cdfa_ (3cdf A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931708Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries)
  8. 931716Domain d3cdfa_: 3cdf A: [173149]
    automated match to d1igml_

Details for d3cdfa_

PDB Entry: 3cdf (more details), 1.53 Å

PDB Description: kI O18/O8 Y87H immunoglobulin light chain variable domain
PDB Compounds: (A:) immuglobulin light chain

SCOPe Domain Sequences for d3cdfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cdfa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
srfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik

SCOPe Domain Coordinates for d3cdfa_:

Click to download the PDB-style file with coordinates for d3cdfa_.
(The format of our PDB-style files is described here.)

Timeline for d3cdfa_: