SCOPe 2.01: Domain d3cdfa_: 3cdf A:

Lineage for d3cdfa_ (3cdf A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries)

8. Domain d3cdfa_: 3cdf A: [173149]
   automated match to d1igml_

Details for d3cdfa_

PDB Entry: 3cdf, 1.53 Å

PDB Description: kI O18/O8 Y87H immunoglobulin light chain variable domain

PDB Compounds: (A:) immuglobulin light chain

SCOPe Domain Sequences for d3cdfa_:

Sequence; same for both SEQRES and ATOM records:

>d3cdfa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdiqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvp
srfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik

Timeline for d3cdfa_:

• d3cdfa_ is new in SCOPe 2.01-stable
  
• d3cdfa_ appears in SCOPe 2.02
  
• d3cdfa_ appears in the current release, SCOPe 2.08