Lineage for d3cdcb_ (3cdc B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931708Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries)
  8. 931715Domain d3cdcb_: 3cdc B: [173146]
    automated match to d1b0wa_

Details for d3cdcb_

PDB Entry: 3cdc (more details), 1.53 Å

PDB Description: kI O18/O8 N34I/Y87H immunoglobulin light chain variable domain
PDB Compounds: (B:) Light Chain Amyloidogenic

SCOPe Domain Sequences for d3cdcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cdcb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik

SCOPe Domain Coordinates for d3cdcb_:

Click to download the PDB-style file with coordinates for d3cdcb_.
(The format of our PDB-style files is described here.)

Timeline for d3cdcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cdca_