Lineage for d3cckb_ (3cck B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442983Protein automated matches [190329] (6 species)
    not a true protein
  7. 1442991Species Human (Homo sapiens) [TaxId:9606] [187151] (6 PDB entries)
  8. 1442995Domain d3cckb_: 3cck B: [173140]
    automated match to d1fm5a_
    complexed with cl

Details for d3cckb_

PDB Entry: 3cck (more details), 1.8 Å

PDB Description: Human CD69
PDB Compounds: (B:) early activation antigen cd69

SCOPe Domain Sequences for d3cckb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cckb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

SCOPe Domain Coordinates for d3cckb_:

Click to download the PDB-style file with coordinates for d3cckb_.
(The format of our PDB-style files is described here.)

Timeline for d3cckb_: