| Class b: All beta proteins [48724] (178 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
| Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries) |
| Domain d3cc0a1: 3cc0 A:264-367 [173127] Other proteins in same PDB: d3cc0a2, d3cc0b2 automated match to d2f0ac1 |
PDB Entry: 3cc0 (more details), 1.75 Å
SCOPe Domain Sequences for d3cc0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc0a1 b.36.1.1 (A:264-367) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksggggeivlwsdip
Timeline for d3cc0a1: