Lineage for d3cc0a1 (3cc0 A:264-367)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395674Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)
  7. 2395683Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)
  8. 2395690Domain d3cc0a1: 3cc0 A:264-367 [173127]
    Other proteins in same PDB: d3cc0a2, d3cc0b2
    automated match to d2f0ac1

Details for d3cc0a1

PDB Entry: 3cc0 (more details), 1.75 Å

PDB Description: the dvl2 pdz domain in complex with the n3 inhibitory peptide
PDB Compounds: (A:) Dishevelled-2

SCOPe Domain Sequences for d3cc0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cc0a1 b.36.1.1 (A:264-367) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
niitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndm
nfenmsnddavrvlrdivhkpgpivltvaksggggeivlwsdip

SCOPe Domain Coordinates for d3cc0a1:

Click to download the PDB-style file with coordinates for d3cc0a1.
(The format of our PDB-style files is described here.)

Timeline for d3cc0a1: