SCOPe 2.05: Domain d3cc0a_: 3cc0 A:

Lineage for d3cc0a_ (3cc0 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [188234] (5 PDB entries)

8. Domain d3cc0a_: 3cc0 A: [173127]
   automated match to d2f0ac1

Details for d3cc0a_

PDB Entry: 3cc0, 1.75 Å

PDB Description: the dvl2 pdz domain in complex with the n3 inhibitory peptide

PDB Compounds: (A:) Dishevelled-2

SCOPe Domain Sequences for d3cc0a_:

Sequence; same for both SEQRES and ATOM records:

>d3cc0a_ b.36.1.1 (A:) Segment polarity protein dishevelled homolog Dvl-2 {Human (Homo sapiens) [TaxId: 9606]}
hmniitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvn
dmnfenmsnddavrvlrdivhkpgpivltvaksggggeivlwsdip

Timeline for d3cc0a_:

• d3cc0a_ first appeared in SCOPe 2.01
  
• d3cc0a_ appears in SCOPe 2.04
  
• d3cc0a_ is called d3cc0a1 in SCOPe 2.06
  
• d3cc0a_ appears in the current release, SCOPe 2.08, called d3cc0a1