Lineage for d3cbda_ (3cbd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005433Species Bacillus megaterium [TaxId:1404] [188479] (5 PDB entries)
  8. 2005438Domain d3cbda_: 3cbd A: [173119]
    automated match to d1bu7a_
    complexed with 140, hem

Details for d3cbda_

PDB Entry: 3cbd (more details), 2.65 Å

PDB Description: Directed Evolution of cytochrome P450 BM3, to octane monoxygenase 139-3
PDB Compounds: (A:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d3cbda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbda_ a.104.1.1 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfardfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadeyievpedmtrltldtiglcgfnyrfnsfyrdqphpfiismira
ldevmnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddlltqmlng
kdpetgeplddgnisyqiitfliaghettsgllsfalyflvknphvlqkvaeeatrvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdevmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d3cbda_:

Click to download the PDB-style file with coordinates for d3cbda_.
(The format of our PDB-style files is described here.)

Timeline for d3cbda_: