SCOPe 2.06: Domain d3cb7b1: 3cb7 B:5-126

Lineage for d3cb7b1 (3cb7 B:5-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (13 species)
   not a true protein

7. Species House fly (Musca domestica) [TaxId:7370] [187696] (3 PDB entries)

8. Domain d3cb7b1: 3cb7 B:5-126 [173115]
   Other proteins in same PDB: d3cb7a2, d3cb7b2
   automated match to d1gd6a_
   complexed with acy, gol, ipa

Details for d3cb7b1

PDB Entry: 3cb7, 1.9 Å

PDB Description: The crystallographic structure of the digestive lysozyme 2 from Musca domestica at 1.9 Ang.

PDB Compounds: (B:) Lys-rich lysozyme 2

SCOPe Domain Sequences for d3cb7b1:

Sequence; same for both SEQRES and ATOM records:

>d3cb7b1 d.2.1.0 (B:5-126) automated matches {House fly (Musca domestica) [TaxId: 7370]}
ktftrcslaremyklgvpknqlarwtciaehessyntkavgslnsngsrdygifqinnyy
wcsppsgafsydeckikcedflvdsiepavkcaqlvlkqqgwtawstwkycdgtlpsidd
cf

Timeline for d3cb7b1:

• d3cb7b1 first appeared in SCOPe 2.01, called d3cb7b_
  
• d3cb7b1 was called d3cb7b_ in SCOPe 2.05
  
• d3cb7b1 appears in SCOPe 2.07
  
• d3cb7b1 appears in the current release, SCOPe 2.08