Lineage for d3cb7b_ (3cb7 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888916Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1888917Protein automated matches [190563] (12 species)
    not a true protein
  7. 1888921Species House fly (Musca domestica) [TaxId:7370] [187696] (3 PDB entries)
  8. 1888927Domain d3cb7b_: 3cb7 B: [173115]
    automated match to d1gd6a_
    complexed with acy, gol, ipa

Details for d3cb7b_

PDB Entry: 3cb7 (more details), 1.9 Å

PDB Description: The crystallographic structure of the digestive lysozyme 2 from Musca domestica at 1.9 Ang.
PDB Compounds: (B:) Lys-rich lysozyme 2

SCOPe Domain Sequences for d3cb7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cb7b_ d.2.1.0 (B:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
eaeaktftrcslaremyklgvpknqlarwtciaehessyntkavgslnsngsrdygifqi
nnyywcsppsgafsydeckikcedflvdsiepavkcaqlvlkqqgwtawstwkycdgtlp
siddcf

SCOPe Domain Coordinates for d3cb7b_:

Click to download the PDB-style file with coordinates for d3cb7b_.
(The format of our PDB-style files is described here.)

Timeline for d3cb7b_: