Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Brucella melitensis [TaxId:29459] [188364] (1 PDB entry) |
Domain d3cb0c_: 3cb0 C: [173112] automated match to d1rz0a_ complexed with fmn |
PDB Entry: 3cb0 (more details), 1.6 Å
SCOPe Domain Sequences for d3cb0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cb0c_ b.45.1.0 (C:) automated matches {Brucella melitensis [TaxId: 29459]} stveskayrdamshyagavqivttagaagrrgltltaacsvsdnpptiliclqkiheenr ifiengvfaintlagphqqladafsgrigltqderfelaaweilatgapvlkgalaafdc rvvsvqdhsthhvlfgevvglsshaeeealiylnrryhklel
Timeline for d3cb0c_: