Lineage for d1br1f_ (1br1 F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997231Protein Myosin Essential Chain [47524] (3 species)
  7. 1997247Species Chicken (Gallus gallus) [TaxId:9031] [47526] (4 PDB entries)
  8. 1997251Domain d1br1f_: 1br1 F: [17311]
    Other proteins in same PDB: d1br1a1, d1br1a2, d1br1c1, d1br1c2, d1br1e1, d1br1e2, d1br1g1, d1br1g2
    complexed with adp, alf, mg

Details for d1br1f_

PDB Entry: 1br1 (more details), 3.5 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site
PDB Compounds: (F:) myosin

SCOPe Domain Sequences for d1br1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br1f_ a.39.1.5 (F:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg

SCOPe Domain Coordinates for d1br1f_:

Click to download the PDB-style file with coordinates for d1br1f_.
(The format of our PDB-style files is described here.)

Timeline for d1br1f_: