Lineage for d3caba_ (3cab A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1490848Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1490849Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1490895Protein Pheromone-binding protein asp1 [101192] (1 species)
  7. 1490896Species Honeybee (Apis mellifera) [TaxId:7460] [101193] (14 PDB entries)
  8. 1490907Domain d3caba_: 3cab A: [173097]
    automated match to d1r5ra_
    complexed with gol

Details for d3caba_

PDB Entry: 3cab (more details), 1.95 Å

PDB Description: Crystal structure of a pheromone binding protein from Apis mellifera soaked at pH 7.0
PDB Compounds: (A:) Pheromone-binding protein ASP1

SCOPe Domain Sequences for d3caba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3caba_ a.39.2.1 (A:) Pheromone-binding protein asp1 {Honeybee (Apis mellifera) [TaxId: 7460]}
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

SCOPe Domain Coordinates for d3caba_:

Click to download the PDB-style file with coordinates for d3caba_.
(The format of our PDB-style files is described here.)

Timeline for d3caba_: