Lineage for d3c9gb_ (3c9g B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958441Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2958442Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2958556Family d.77.1.0: automated matches [191541] (1 protein)
    not a true family
  6. 2958557Protein automated matches [190927] (3 species)
    not a true protein
  7. 2958558Species Archaeoglobus fulgidus [TaxId:224325] [188433] (1 PDB entry)
  8. 2958560Domain d3c9gb_: 3c9g B: [173094]
    automated match to d2pzza1

Details for d3c9gb_

PDB Entry: 3c9g (more details), 2.3 Å

PDB Description: crystal structure of uncharacterized upf0201 protein af_135
PDB Compounds: (B:) UPF0200/UPF0201 protein AF_1395

SCOPe Domain Sequences for d3c9gb_:

Sequence, based on SEQRES records: (download)

>d3c9gb_ d.77.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
veieirtkihptesedkvlkairnifpdaeieiseegevygraysldrfrellrkqrild
tarseilkgrngkevtiylnkqtatvsrinfcdenavlspikvtfrlnnipfsrfldyia
petkdgrpv

Sequence, based on observed residues (ATOM records): (download)

>d3c9gb_ d.77.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
veieirtkihptesedkvlkairnifpdaeieiseegevygraysldrfrellrkqrild
tarseilkgrngkevtiylnkqtatvsrinfcdenavspikvtfrlnnipfsrfldyiap
etkdgrpv

SCOPe Domain Coordinates for d3c9gb_:

Click to download the PDB-style file with coordinates for d3c9gb_.
(The format of our PDB-style files is described here.)

Timeline for d3c9gb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3c9ga_