![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
![]() | Superfamily d.77.1: RL5-like [55282] (3 families) ![]() |
![]() | Family d.77.1.0: automated matches [191541] (1 protein) not a true family |
![]() | Protein automated matches [190927] (3 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:224325] [188433] (1 PDB entry) |
![]() | Domain d3c9ga_: 3c9g A: [173093] automated match to d2pzza1 |
PDB Entry: 3c9g (more details), 2.3 Å
SCOPe Domain Sequences for d3c9ga_:
Sequence, based on SEQRES records: (download)
>d3c9ga_ d.77.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} knveieirtkihptesedkvlkairnifpdaeieiseegevygraysldrfrellrkqri ldtarseilkgrngkevtiylnkqtatvsrinfcdenavlspikvtfrlnnipfsrfldy iapetkdgrpv
>d3c9ga_ d.77.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]} knveieirtkihptesedkvlkairnifpdaeieiseegevygraysldrfrellrkqri ldtarseilkgrngkevtiylnkqtatvsrinfcdenavspikvtfrlnnipfsrfldyi apetkdgrpv
Timeline for d3c9ga_: