Lineage for d3c98b_ (3c98 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997864Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 1997877Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 1997878Family a.47.2.1: t-snare proteins [47662] (6 protein domains)
  6. 1997882Protein Syntaxin 1A N-terminal domain [47663] (2 species)
  7. 1997886Species Norway rat (Rattus norvegicus) [TaxId:10116] [47664] (3 PDB entries)
  8. 1997890Domain d3c98b_: 3c98 B: [173092]
    Other proteins in same PDB: d3c98a_

Details for d3c98b_

PDB Entry: 3c98 (more details), 2.6 Å

PDB Description: Revised structure of the munc18a-syntaxin1 complex
PDB Compounds: (B:) syntaxin-1a

SCOPe Domain Sequences for d3c98b_:

Sequence, based on SEQRES records: (download)

>d3c98b_ a.47.2.1 (B:) Syntaxin 1A N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kdrtqelrtakdsdddddvtvtvdrdrfmdeffeqveeirgfidkiaenveevkrkhsai
laspnpdektkeeleelmsdikktankvrsklksieqsieqeeglnrssadlrirktqhs
tlsrkfvevmseynatqsdyrerckgriqrqleitgrtttseeledmlesgnpaifasgi
imdssiskqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehav
dyverav

Sequence, based on observed residues (ATOM records): (download)

>d3c98b_ a.47.2.1 (B:) Syntaxin 1A N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kdrtqelrdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleel
msdikktankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatq
sdyrerckgriqrqleitgrtttseeledmlesgnpaifasgiimdssiskqalseietr
hseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav

SCOPe Domain Coordinates for d3c98b_:

Click to download the PDB-style file with coordinates for d3c98b_.
(The format of our PDB-style files is described here.)

Timeline for d3c98b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3c98a_