Lineage for d3c8ta_ (3c8t A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010461Species Mesorhizobium sp. [TaxId:266779] [188363] (1 PDB entry)
  8. 2010462Domain d3c8ta_: 3c8t A: [173090]
    automated match to d1q5na_

Details for d3c8ta_

PDB Entry: 3c8t (more details), 2.2 Å

PDB Description: crystal structure of fumarate lyase from mesorhizobium sp. bnc1
PDB Compounds: (A:) Fumarate lyase

SCOPe Domain Sequences for d3c8ta_:

Sequence, based on SEQRES records: (download)

>d3c8ta_ a.127.1.0 (A:) automated matches {Mesorhizobium sp. [TaxId: 266779]}
plygrsfaddkmrelfsaqsfisrcvetevalaraqarlgiipedaaagitaaartfape
merlrddteivgypilplveqlsahageagkylhwgattqdimdtatvlqirdglalisr
riesvrkalaalarnhrdtpmagrthlqhalpvtfgykaavwlsafdrhaarleeisprv
lvvefsgasgtlaslgtrgldvqrelarelnlgvpsitwhsardavaetvqflalvsgsl
gklamdisimmttelgevaepfvrhrgasstmpqkqnpvscelilagarivrnhatsmld
amihdferatgpwhlewsavpegfavasgilyqaefmlgglqvfpdrmrenldhsrgliv
aeavmmalaphtgrkeahdivylgcrravedktglfevlrtmpevakplgeealrdltdp
rnylgsagamvdnvlggr

Sequence, based on observed residues (ATOM records): (download)

>d3c8ta_ a.127.1.0 (A:) automated matches {Mesorhizobium sp. [TaxId: 266779]}
plygrsfaddkmrelfsaqsfisrcvetevalaraqarlgiipedaaagitaaartfape
merlrddteivgypilplveqlsahageagkylhwgattqdimdtatvlqirdglalisr
riesvrkalaalarnhrdtpmagrthlqhalpvtfgykaavwlsafdrhaarleeisprv
lvvefsgasgtlaslgtrgldvqrelarelnlgvpsitwhsardavaetvqflalvsgsl
gklamdisimmttelgevaepnpvscelilagarivrnhatsmldamihdferatgpwhl
ewsavpegfavasgilyqaefmlgglqvfpdrmrenldhsrglivaeavmmalaphtgrk
eahdivylgcrravedktglfevlrtmpevakplgeealrdltdprnylgsagamvdnvl
ggr

SCOPe Domain Coordinates for d3c8ta_:

Click to download the PDB-style file with coordinates for d3c8ta_.
(The format of our PDB-style files is described here.)

Timeline for d3c8ta_: