SCOPe 2.08: Domain d3c8ob_: 3c8o B:

Lineage for d3c8ob_ (3c8o B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.7: RraA-like [89562] (2 families)
   structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase

5. Family c.8.7.0: automated matches [191574] (1 protein)
   not a true family

6. Protein automated matches [191008] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [188757] (1 PDB entry)

8. Domain d3c8ob_: 3c8o B: [173084]
   automated match to d1q5xa_
   complexed with edo, peg, pg4, pge

Details for d3c8ob_

PDB Entry: 3c8o, 1.9 Å

PDB Description: the crystal structure of rraa from pao1

PDB Compounds: (B:) Regulator of ribonuclease activity A

SCOPe Domain Sequences for d3c8ob_:

Sequence; same for both SEQRES and ATOM records:

>d3c8ob_ c.8.7.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mhyvtpdlcdaypelvqvvepmfsnfggrdsfggeivtikcfednslvkeqvdkdgkgkv
lvvdgggslrrallgdmlaekaakngwegivvygcirdvdviaqtdlgvqalashplktd
krgigdlnvavtfggvtfrpgefvyadnngiivspqalkmp

Timeline for d3c8ob_:

• d3c8ob_ first appeared in SCOPe 2.01
  
• d3c8ob_ appears in SCOPe 2.07