Lineage for d3c8ob_ (3c8o B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851428Superfamily c.8.7: RraA-like [89562] (2 families) (S)
    structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase
  5. 2851456Family c.8.7.0: automated matches [191574] (1 protein)
    not a true family
  6. 2851457Protein automated matches [191008] (1 species)
    not a true protein
  7. 2851458Species Pseudomonas aeruginosa [TaxId:287] [188757] (1 PDB entry)
  8. 2851460Domain d3c8ob_: 3c8o B: [173084]
    automated match to d1q5xa_
    complexed with edo, peg, pg4, pge

Details for d3c8ob_

PDB Entry: 3c8o (more details), 1.9 Å

PDB Description: the crystal structure of rraa from pao1
PDB Compounds: (B:) Regulator of ribonuclease activity A

SCOPe Domain Sequences for d3c8ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c8ob_ c.8.7.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mhyvtpdlcdaypelvqvvepmfsnfggrdsfggeivtikcfednslvkeqvdkdgkgkv
lvvdgggslrrallgdmlaekaakngwegivvygcirdvdviaqtdlgvqalashplktd
krgigdlnvavtfggvtfrpgefvyadnngiivspqalkmp

SCOPe Domain Coordinates for d3c8ob_:

Click to download the PDB-style file with coordinates for d3c8ob_.
(The format of our PDB-style files is described here.)

Timeline for d3c8ob_: