Lineage for d2mysb_ (2mys B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47708Protein Myosin Essential Chain [47524] (2 species)
  7. 47716Species Chicken (Gallus gallus) [TaxId:9031] [47526] (3 PDB entries)
  8. 47717Domain d2mysb_: 2mys B: [17308]
    Other proteins in same PDB: d2mysa1, d2mysa2, d2mysc_

Details for d2mysb_

PDB Entry: 2mys (more details), 2.8 Å

PDB Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains

SCOP Domain Sequences for d2mysb_:

Sequence, based on SEQRES records: (download)

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

Sequence, based on observed residues (ATOM records): (download)

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggftpeeiknmwaa
fpvdyknicyvithgeda

SCOP Domain Coordinates for d2mysb_:

Click to download the PDB-style file with coordinates for d2mysb_.
(The format of our PDB-style files is described here.)

Timeline for d2mysb_: