Lineage for d2mysb_ (2mys B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3359Protein Myosin Essential Chain [47524] (2 species)
  7. 3367Species Chicken (Gallus gallus) [TaxId:9031] [47526] (3 PDB entries)
  8. 3368Domain d2mysb_: 2mys B: [17308]
    Other proteins in same PDB: d2mysa1, d2mysa2, d2mysc_

Details for d2mysb_

PDB Entry: 2mys (more details), 2.8 Å

PDB Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains
PDB Compounds: (B:)

SCOP Domain Sequences for d2mysb_:

Sequence, based on SEQRES records: (download)

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

Sequence, based on observed residues (ATOM records): (download)

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus)}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggftpeeiknmwaa
fpvdyknicyvithgeda

SCOP Domain Coordinates for d2mysb_:

Click to download the PDB-style file with coordinates for d2mysb_.
(The format of our PDB-style files is described here.)

Timeline for d2mysb_: