Lineage for d2mysb_ (2mys B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711040Protein Myosin Essential Chain [47524] (3 species)
  7. 2711056Species Chicken (Gallus gallus) [TaxId:9031] [47526] (4 PDB entries)
  8. 2711057Domain d2mysb_: 2mys B: [17308]
    Other proteins in same PDB: d2mysa1, d2mysa2, d2mysc_
    complexed with mg, so4

Details for d2mysb_

PDB Entry: 2mys (more details), 2.8 Å

PDB Description: myosin subfragment-1, alpha carbon coordinates only for the two light chains
PDB Compounds: (B:) myosin

SCOPe Domain Sequences for d2mysb_:

Sequence, based on SEQRES records: (download)

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggrftpeeiknmwa
afppdvagnvdyknicyvithgeda

Sequence, based on observed residues (ATOM records): (download)

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}
fdeteiedfkeaftvidqnadgiidkddlretfaamgrlnvkneeldamikeasgpinft
vfltmfgeklkgadpedvimgafkvldpdgkgsikksfleellttgggftpeeiknmwaa
fpvdyknicyvithgeda

SCOPe Domain Coordinates for d2mysb_:

Click to download the PDB-style file with coordinates for d2mysb_.
(The format of our PDB-style files is described here.)

Timeline for d2mysb_: