SCOPe 2.06: Domain d3c7wa_: 3c7w A:

Lineage for d3c7wa_ (3c7w A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3c7wa_: 3c7w A: [173075]
   automated match to d1lyda_
   complexed with bme, cl

Details for d3c7wa_

PDB Entry: 3c7w, 1.77 Å

PDB Description: contributions of all 20 amino acids at site 96 to the stability and structure of t4 lysozyme

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3c7wa_:

Sequence; same for both SEQRES and ATOM records:

>d3c7wa_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrkcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d3c7wa_:

• d3c7wa_ first appeared in SCOPe 2.01
  
• d3c7wa_ appears in SCOPe 2.05
  
• d3c7wa_ appears in SCOPe 2.07
  
• d3c7wa_ appears in the current release, SCOPe 2.08