Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Escherichia coli [TaxId:562] [188952] (3 PDB entries) |
Domain d3c7ma_: 3c7m A: [173071] automated match to d1beda_ complexed with cd, cl, peg, pge |
PDB Entry: 3c7m (more details), 1.55 Å
SCOPe Domain Sequences for d3c7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7ma_ c.47.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} ftegtdymvlekpipnadktlikvfsyacpfcykydkavtgpvsekvkdivaftpfhlet kgeygkqasevfavlinkdkaagislfdansqfkkakfayyaayhdkkerwsdgkdpaaf iktgldaagmsqadfeaalkepavqetlekwkasydvakiqgvpayvvngkyliytksik sidamadlirelask
Timeline for d3c7ma_: