SCOPe 2.01: Domain d3c7ma_: 3c7m A:

Lineage for d3c7ma_ (3c7m A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188952] (2 PDB entries)

8. Domain d3c7ma_: 3c7m A: [173071]
   automated match to d1beda_
   complexed with cd, cl, peg, pge

Details for d3c7ma_

PDB Entry: 3c7m, 1.55 Å

PDB Description: Crystal structure of reduced DsbL

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA-like

SCOPe Domain Sequences for d3c7ma_:

Sequence; same for both SEQRES and ATOM records:

>d3c7ma_ c.47.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
ftegtdymvlekpipnadktlikvfsyacpfcykydkavtgpvsekvkdivaftpfhlet
kgeygkqasevfavlinkdkaagislfdansqfkkakfayyaayhdkkerwsdgkdpaaf
iktgldaagmsqadfeaalkepavqetlekwkasydvakiqgvpayvvngkyliytksik
sidamadlirelask

Timeline for d3c7ma_:

• d3c7ma_ is new in SCOPe 2.01-stable
  
• d3c7ma_ appears in SCOPe 2.02
  
• d3c7ma_ appears in the current release, SCOPe 2.08