SCOPe 2.05: Domain d3c7kd_: 3c7k D:

Lineage for d3c7kd_ (3c7k D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [188430] (2 PDB entries)

8. Domain d3c7kd_: 3c7k D: [173070]
   automated match to d2ik8b1
   complexed with alf, gdp, mg

Details for d3c7kd_

PDB Entry: 3c7k, 2.9 Å

PDB Description: molecular architecture of galphao and the structural basis for rgs16- mediated deactivation

PDB Compounds: (D:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d3c7kd_:

Sequence; same for both SEQRES and ATOM records:

>d3c7kd_ a.91.1.1 (D:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
sfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhifdeyirs
eapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspay

Timeline for d3c7kd_:

• d3c7kd_ first appeared in SCOPe 2.01
  
• d3c7kd_ appears in SCOPe 2.04
  
• d3c7kd_ appears in SCOPe 2.06
  
• d3c7kd_ appears in the current release, SCOPe 2.08