| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
| Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [188430] (2 PDB entries) |
| Domain d3c7kd_: 3c7k D: [173070] automated match to d2ik8b1 complexed with alf, gdp, mg |
PDB Entry: 3c7k (more details), 2.9 Å
SCOPe Domain Sequences for d3c7kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7kd_ a.91.1.1 (D:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
sfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhifdeyirs
eapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspay
Timeline for d3c7kd_: