Lineage for d3c74e_ (3c74 E:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173040Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1173041Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1173372Protein Uridine phosphorylase [53176] (2 species)
  7. 1173474Species Salmonella typhimurium [TaxId:90371] [117656] (23 PDB entries)
    Uniprot P0A1F6
  8. 1173550Domain d3c74e_: 3c74 E: [173068]
    automated match to d1ryza_
    complexed with anu

Details for d3c74e_

PDB Entry: 3c74 (more details), 2.38 Å

PDB Description: x-ray structure of the uridine phosphorylase from salmonella typhimurium in complex with 2,2'-anhydrouridine at 2.38a resolution
PDB Compounds: (E:) Uridine phosphorylase

SCOPe Domain Sequences for d3c74e_:

Sequence, based on SEQRES records: (download)

>d3c74e_ c.56.2.1 (E:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d3c74e_ c.56.2.1 (E:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipshavkivveaarrl
l

SCOPe Domain Coordinates for d3c74e_:

Click to download the PDB-style file with coordinates for d3c74e_.
(The format of our PDB-style files is described here.)

Timeline for d3c74e_: