SCOPe 2.06: Domain d3c73a_: 3c73 A:

Lineage for d3c73a_ (3c73 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188552] (3 PDB entries)

8. Domain d3c73a_: 3c73 A: [173062]
   automated match to d1su9a_
   complexed with so4

Details for d3c73a_

PDB Entry: 3c73, 2.5 Å

PDB Description: structure of cehc variant resa

PDB Compounds: (A:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d3c73a_:

Sequence; same for both SEQRES and ATOM records:

>d3c73a_ c.47.1.10 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcehckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpg

Timeline for d3c73a_:

• d3c73a_ first appeared in SCOPe 2.01
  
• d3c73a_ appears in SCOPe 2.05
  
• d3c73a_ appears in SCOPe 2.07
  
• d3c73a_ appears in the current release, SCOPe 2.08