| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [188552] (3 PDB entries) |
| Domain d3c73a_: 3c73 A: [173062] automated match to d1su9a_ complexed with so4 |
PDB Entry: 3c73 (more details), 2.5 Å
SCOPe Domain Sequences for d3c73a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c73a_ c.47.1.10 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcehckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpg
Timeline for d3c73a_: