Lineage for d3c73a_ (3c73 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878129Species Bacillus subtilis [TaxId:1423] [188552] (3 PDB entries)
  8. 2878131Domain d3c73a_: 3c73 A: [173062]
    automated match to d1su9a_
    complexed with so4

Details for d3c73a_

PDB Entry: 3c73 (more details), 2.5 Å

PDB Description: structure of cehc variant resa
PDB Compounds: (A:) Thiol-disulfide oxidoreductase resA

SCOPe Domain Sequences for d3c73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c73a_ c.47.1.10 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
sdapnfvledtngkrielsdlkgkgvflnfwgtwcehckkefpymanqykhfksqgveiv
avnvgeskiavhnfmksygvnfpvvldtdrqvldaydvsplpttflinpegkvvkvvtgt
mtesmihdymnlikpg

SCOPe Domain Coordinates for d3c73a_:

Click to download the PDB-style file with coordinates for d3c73a_.
(The format of our PDB-style files is described here.)

Timeline for d3c73a_: