Lineage for d3c62a_ (3c62 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988318Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1988319Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 1988331Protein automated matches [190502] (2 species)
    not a true protein
  7. 1988332Species Escherichia coli [TaxId:562] [187450] (39 PDB entries)
  8. 1988357Domain d3c62a_: 3c62 A: [173052]
    automated match to d1qq3a_
    complexed with ca, hem, zn

Details for d3c62a_

PDB Entry: 3c62 (more details), 1.87 Å

PDB Description: tetrameric cytochrome cb562 (h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d3c62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c62a_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemhd
fdhgfdilvgqihaalhlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3c62a_:

Click to download the PDB-style file with coordinates for d3c62a_.
(The format of our PDB-style files is described here.)

Timeline for d3c62a_: