Lineage for d3c61c_ (3c61 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969026Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 969027Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 969275Protein automated matches [190228] (7 species)
    not a true protein
  7. 969288Species Leishmania donovani [TaxId:5661] [188354] (1 PDB entry)
  8. 969291Domain d3c61c_: 3c61 C: [173050]
    automated match to d2b4ga1
    complexed with azi, cl, dtu, fmn, gol, oro

Details for d3c61c_

PDB Entry: 3c61 (more details), 1.8 Å

PDB Description: crystal structure of dihydroorotate dehydrogenase from leishmania donovani
PDB Compounds: (C:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d3c61c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c61c_ c.1.4.1 (C:) automated matches {Leishmania donovani [TaxId: 5661]}
tmslqvdllnntfanpfmnaagvmcsttedlvamtesasgslvsksctpalregnptpry
ralplgsinsmglpnngfdfylayaaeqhdygrkplflsmsglsvrenvemckrlaavat
ekgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaa
eilnefpqvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalanvnafyr
rcpgklifgcggvytgedaflhvlagasmvqvgtalheegpaiferltaelldvmakkgy
qtldefrgkvrtld

SCOPe Domain Coordinates for d3c61c_:

Click to download the PDB-style file with coordinates for d3c61c_.
(The format of our PDB-style files is described here.)

Timeline for d3c61c_: