Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (7 species) not a true protein |
Species Leishmania donovani [TaxId:5661] [188354] (1 PDB entry) |
Domain d3c61c_: 3c61 C: [173050] automated match to d2b4ga1 complexed with azi, cl, dtu, fmn, gol, oro |
PDB Entry: 3c61 (more details), 1.8 Å
SCOPe Domain Sequences for d3c61c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c61c_ c.1.4.1 (C:) automated matches {Leishmania donovani [TaxId: 5661]} tmslqvdllnntfanpfmnaagvmcsttedlvamtesasgslvsksctpalregnptpry ralplgsinsmglpnngfdfylayaaeqhdygrkplflsmsglsvrenvemckrlaavat ekgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaa eilnefpqvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalanvnafyr rcpgklifgcggvytgedaflhvlagasmvqvgtalheegpaiferltaelldvmakkgy qtldefrgkvrtld
Timeline for d3c61c_: