Lineage for d3c56a_ (3c56 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086701Species Helicobacter pylori [TaxId:210] [188576] (3 PDB entries)
  8. 2086704Domain d3c56a_: 3c56 A: [173046]
    automated match to d1rv8a_
    complexed with ph4, zn

Details for d3c56a_

PDB Entry: 3c56 (more details), 2.3 Å

PDB Description: Class II fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with N-(3-Hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3c56a_:

Sequence, based on SEQRES records: (download)

>d3c56a_ c.1.10.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiednisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
lgsanki

Sequence, based on observed residues (ATOM records): (download)

>d3c56a_ c.1.10.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiavlvnpkeaeqfvkesqvdylapaigtshgafkfkgepk
ldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkggin
kvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki

SCOPe Domain Coordinates for d3c56a_:

Click to download the PDB-style file with coordinates for d3c56a_.
(The format of our PDB-style files is described here.)

Timeline for d3c56a_: