Lineage for d1scmb_ (1scm B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47708Protein Myosin Essential Chain [47524] (2 species)
  7. 47709Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (5 PDB entries)
  8. 47712Domain d1scmb_: 1scm B: [17304]
    Other proteins in same PDB: d1scmc_

Details for d1scmb_

PDB Entry: 1scm (more details), 2.8 Å

PDB Description: structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution

SCOP Domain Sequences for d1scmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scmb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians)}
lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
apveggkfdyvkftamik

SCOP Domain Coordinates for d1scmb_:

Click to download the PDB-style file with coordinates for d1scmb_.
(The format of our PDB-style files is described here.)

Timeline for d1scmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1scmc_