Lineage for d3c41j_ (3c41 J:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128538Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)
  8. 2128551Domain d3c41j_: 3c41 J: [173032]
    automated match to d1b0ua_
    complexed with anp, mg

Details for d3c41j_

PDB Entry: 3c41 (more details), 2.25 Å

PDB Description: abc protein artp in complex with amp-pnp/mg2+
PDB Compounds: (J:) Amino acid ABC transporter (ArtP)

SCOPe Domain Sequences for d3c41j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c41j_ c.37.1.0 (J:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
vf

SCOPe Domain Coordinates for d3c41j_:

Click to download the PDB-style file with coordinates for d3c41j_.
(The format of our PDB-style files is described here.)

Timeline for d3c41j_: