SCOPe 2.04: Domain d3c3ya_: 3c3y A:

Lineage for d3c3ya_ (3c3y A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein automated matches [190251] (4 species)
   not a true protein

7. Species Mesembryanthemum crystallinum [TaxId:3544] [188404] (1 PDB entry)

8. Domain d3c3ya_: 3c3y A: [173030]
   automated match to d1suia1
   complexed with ca, sah

Details for d3c3ya_

PDB Entry: 3c3y, 1.37 Å

PDB Description: Crystal Structure of PFOMT, Phenylpropanoid and Flavonoid O-methyltransferase from M. crystallinum

PDB Compounds: (A:) O-methyltransferase

SCOPe Domain Sequences for d3c3ya_:

Sequence; same for both SEQRES and ATOM records:

>d3c3ya_ c.66.1.1 (A:) automated matches {Mesembryanthemum crystallinum [TaxId: 3544]}
gllqseelcqyilrtsvypreagflkelreaneshpdsymstsplagqlmsfvlklvnak
ktievgvftgysllltalsipddgkitaidfdreayeiglpfirkagvehkinfiesdam
laldnllqgqesegsydfgfvdadkpnyikyherlmklvkvggivaydntlwggtvaqpe
sevpdfmkenreavielnkllaadprieivhlplgdgitfcrrly

Timeline for d3c3ya_:

• d3c3ya_ first appeared in SCOPe 2.01
  
• d3c3ya_ appears in SCOPe 2.03
  
• d3c3ya_ appears in SCOPe 2.05
  
• d3c3ya_ appears in the current release, SCOPe 2.08