Lineage for d3c3pc_ (3c3p C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000528Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1000529Protein automated matches [190689] (17 species)
    not a true protein
  7. 1000561Species Geobacter sulfurreducens [TaxId:243231] [188338] (1 PDB entry)
  8. 1000564Domain d3c3pc_: 3c3p C: [173027]
    automated match to d2avda1
    complexed with cl, edo, peg

Details for d3c3pc_

PDB Entry: 3c3p (more details), 1.9 Å

PDB Description: crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution
PDB Compounds: (C:) Methyltransferase

SCOPe Domain Sequences for d3c3pc_:

Sequence, based on SEQRES records: (download)

>d3c3pc_ c.66.1.0 (C:) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
ipivdsrigayldgllpeadpvvaameqiarernipivdrqtgrllyllarikqpqlvvv
pgdglgcaswwfaraisissrvvmidpdrdnveharrmlhdnglidrvelqvgdplgiaa
gqrdidilfmdcdvfngadvlermnrclaknalliavnalrrgsvaeshedpetaalref
nhhlsrrrdffttivpvgngvllgyrls

Sequence, based on observed residues (ATOM records): (download)

>d3c3pc_ c.66.1.0 (C:) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
ipivdsrigayldgllpeadpvvaameqiarernipivdrqtgrllyllarikqpqlvvv
pgdglgcaswwfaraisissrvvmidpdrdnveharrmlhdnglidrvelqvgdplgiaa
gqrdidilfmdcdvfngadvlermnrclaknalliavnalrrglrefnhhlsrrrdfftt
ivpvgngvllgyrls

SCOPe Domain Coordinates for d3c3pc_:

Click to download the PDB-style file with coordinates for d3c3pc_.
(The format of our PDB-style files is described here.)

Timeline for d3c3pc_: