Lineage for d3c3pa1 (3c3p A:1-209)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502346Species Geobacter sulfurreducens [TaxId:243231] [188338] (1 PDB entry)
  8. 2502347Domain d3c3pa1: 3c3p A:1-209 [173025]
    Other proteins in same PDB: d3c3pa2
    automated match to d2avda1
    complexed with cl, edo, peg

Details for d3c3pa1

PDB Entry: 3c3p (more details), 1.9 Å

PDB Description: crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d3c3pa1:

Sequence, based on SEQRES records: (download)

>d3c3pa1 c.66.1.0 (A:1-209) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
mipivdsrigayldgllpeadpvvaameqiarernipivdrqtgrllyllarikqpqlvv
vpgdglgcaswwfaraisissrvvmidpdrdnveharrmlhdnglidrvelqvgdplgia
agqrdidilfmdcdvfngadvlermnrclaknalliavnalrrgsvaeshedpetaalre
fnhhlsrrrdffttivpvgngvllgyrls

Sequence, based on observed residues (ATOM records): (download)

>d3c3pa1 c.66.1.0 (A:1-209) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
mipivdsrigayldgllpeadpvvaameqiarernipivdrqtgrllyllarikqpqlvv
vpgdglgcaswwfaraisissrvvmidpdrdnveharrmlhdnglidrvelqvgdplgia
agqrdidilfmdcdvfngadvlermnrclaknalliavnalrrgalrefnhhlsrrrdff
ttivpvgngvllgyrls

SCOPe Domain Coordinates for d3c3pa1:

Click to download the PDB-style file with coordinates for d3c3pa1.
(The format of our PDB-style files is described here.)

Timeline for d3c3pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c3pa2